PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0040s0500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 653aa    MW: 74077.5 Da    PI: 5.8328
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0040s0500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.23.7e-1112796484374
                    GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             +++ cAea  sgd + a+a L+++++++sp gd++qRla+yf+++L+arla+++  l+   +++++s ++ +e l+a++l++ ++P+
  SapurV1A.0040s0500.1.p 279 QIILCAEAAGSGDRKTASAKLKQIRQHSSPFGDANQRLAHYFANGLEARLAGTGMLLS--GHVTQNS-STAAEILKAYELYVTICPF 362
                             7889************************************************444444..3333333.469**************** PP

                    GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                              k+++l   ++I + ++++  vHiiDf+is+G+QWp+++   + Rp+gpp++RiTg++ p++g   +e++eetg+rL+++A++++vp
  SapurV1A.0040s0500.1.p 363 RKMTNLCGSRTIARVADKAASVHIIDFGISYGFQWPCFIYRQSLRPGGPPRIRITGIELPQPGfrPAERIEETGRRLKRLADRMNVP 449
                             **************************************************************9************************ PP

                    GRAS 176 fefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                             fe+++ +a+++e++++e+L++++  +E+++Vn++ +l++l+d++v ++s+rd+vLkl+k+++P+v+ +  ++ + n++ F++rf ea
  SapurV1A.0040s0500.1.p 450 FEYDA-IAQKWETIQYEDLKIDRdrDEVIVVNCMDRLKNLPDDTVVQNSPRDAVLKLIKRINPDVFLHGVRNGSFNAPFFVTRFREA 535
                             *****.7**************9999************************************************************** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                             l +ysa fd+lea++pre++er + Ere++gr+++nvvacegaer+er et+++Wr+r  ++GF+++pl +++ k++k++   +++d
  SapurV1A.0040s0500.1.p 536 LFHYSAYFDMLEANAPREDQERLVFEREMIGRDAMNVVACEGAERIERPETYKQWRMRSLRMGFRQIPLHQSVIKKVKSIKPDYHKD 622
                             *************************************************************************************77 PP

                    GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                              + v+e+ ++l+lgWk++   ++SaW+
  SapurV1A.0040s0500.1.p 623 -FIVDEDGQWLLLGWKGKIFHAISAWK 648
                             .*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.863250629IPR005202Transcription factor GRAS
PfamPF035141.3E-108279648IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MVIDSMEPPS SPNILQSPTE NPSLGSSSDE DTAYNSETND FSHAVLKYIH DILMEDDLGD  60
KTCMLQDCLA LQAAEKSLYD VLGEESPPSD HFPPCLAQIN ESPDENFSTT RSGQSSVLQS  120
FYSPENVFVI PDVHTEIQSF RQFNGVTGNS DKLLPYSHSE NFSSMRKAPD PPEPEEEVVA  180
DRIQNNGKNY SSNYQYDSND YLEEGRGKKQ HSISDSTHLE LLDDAFLHSI ENGVPIPCPL  240
HDISRIAAYN KFLHDEQLAA SRVRMRTLAS KREADMWTQI ILCAEAAGSG DRKTASAKLK  300
QIRQHSSPFG DANQRLAHYF ANGLEARLAG TGMLLSGHVT QNSSTAAEIL KAYELYVTIC  360
PFRKMTNLCG SRTIARVADK AASVHIIDFG ISYGFQWPCF IYRQSLRPGG PPRIRITGIE  420
LPQPGFRPAE RIEETGRRLK RLADRMNVPF EYDAIAQKWE TIQYEDLKID RDRDEVIVVN  480
CMDRLKNLPD DTVVQNSPRD AVLKLIKRIN PDVFLHGVRN GSFNAPFFVT RFREALFHYS  540
AYFDMLEANA PREDQERLVF EREMIGRDAM NVVACEGAER IERPETYKQW RMRSLRMGFR  600
QIPLHQSVIK KVKSIKPDYH KDFIVDEDGQ WLLLGWKGKI FHAISAWKPV QE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-452796486375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314169.10.0hypothetical protein POPTR_0009s03830g
TrEMBLB9HPF50.0B9HPF5_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-160SCARECROW-like 14